SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049653 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049653
Domain Number 1 Region: 33-329
Classification Level Classification E-value
Superfamily L domain-like 8.28e-59
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 396-694
Classification Level Classification E-value
Superfamily L domain-like 5.02e-54
Family Ngr ectodomain-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049653   Gene: ENSPTRG00000014420   Transcript: ENSPTRT00000026946
Sequence length 762
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:39955999:39967882:-1 gene:ENSPTRG00000014420 transcript:ENSPTRT00000026946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPRSSTHVPLVLPLLVLLLLAPARQATAQRCPQACICDNSRRHVACRHQNLTEVPDAI
PELTQRLDLQGNLLKVIPAAAFQGVPHLTHLDLRHCQVELVAEGAFRGLGRLLLLNLASN
HLRELPQEALDGLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNVLVYLPAMAFQG
LLRVRWLRLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLELGHN
PLTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTLPPLQGPG
QLRRLRLQGNPLWCGCQARPLLEWLARARVRSDGACQGPRRLRGEALDALRPWDLRCPGD
AAQEEEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVCVPESRHSSCEGCGLQAVP
RGFPNDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALAGLGRLIYLYL
SDNQLAGLSAAALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGD
LGGTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQL
SGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPGLQSLHLQKNQLRALPA
LPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLRVGATCATPPNARGQRVKAAAAVFE
ACPGWAARKAKRTPASRPSARRTPIKGRQCGADKVGKEKGRL
Download sequence
Identical sequences H2R6Z0
ENSPTRP00000049653 ENSPTRP00000049653 XP_016794744.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]