SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049843 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049843
Domain Number 1 Region: 21-300
Classification Level Classification E-value
Superfamily L domain-like 6.24e-64
Family Ngr ectodomain-like 0.000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049843   Gene: ENSPTRG00000014079   Transcript: ENSPTRT00000026306
Sequence length 466
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:18680939:18682336:-1 gene:ENSPTRG00000014079 transcript:ENSPTRT00000026306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPATSQRIFLHGN
RISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFH
GLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHG
NRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALA
PLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKRLAANDLQ
GCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGD
SPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCSRKNRTRS
HCRLGQAGSGGGGTGDSEGSGALPSLTCSLTPLGLALVLWTVLGPC
Download sequence
Identical sequences ENSPTRP00000049843 ENSPTRP00000049843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]