SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049961 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049961
Domain Number 1 Region: 153-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.46e-69
Family Papain-like 0.0000132
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049961
Domain Number - Region: 93-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.000105
Family VWC domain 0.068
Further Details:      
 
Domain Number - Region: 75-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000432
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049961   Gene: ENSPTRG00000018295   Transcript: ENSPTRT00000057114
Sequence length 476
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:55050308:55132035:1 gene:ENSPTRG00000018295 transcript:ENSPTRT00000057114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNF
GCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGC
FKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVHPELIEQVNKGDYGWTAQNYSQFW
GMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPATTDLPEFFVASYKWPGWTHGPLDQKNC
AASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
LVSHACYPLFKDHNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSPPYRVSSN
ETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP
Download sequence
Identical sequences H2R763
9598.ENSPTRP00000049961 XP_518550.3.37143 ENSPTRP00000049961 ENSPTRP00000049961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]