SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050000 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050000
Domain Number 1 Region: 107-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 28-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000157
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 142-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000188
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 69-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 5 Region: 185-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000463
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000050000
Domain Number - Region: 1-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050000   Gene: ENSPTRG00000001194   Transcript: ENSPTRT00000048318
Sequence length 236
Comment pep:novel chromosome:CHIMP2.1.4:1:116598819:116682040:1 gene:ENSPTRG00000001194 transcript:ENSPTRT00000048318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVTYHNGTGYCKCPEGLLGEYCQHRDPYEKNRCQNGGTCVAQAMLGKATCRCASGFTGE
DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC
TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQDGGTCLNLPGSYQCQCPQGFTGQYCD
SLYVPCAPSPCVNGGTCRQTGDFTFECSCLPETVRRGTELWERDRQVWNGKEHDEN
Download sequence
Identical sequences ENSPTRP00000050000 ENSPTRP00000050000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]