SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050031 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050031
Domain Number 1 Region: 158-222
Classification Level Classification E-value
Superfamily SEA domain 0.0000863
Family SEA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050031   Gene: ENSPTRG00000018241   Transcript: ENSPTRT00000057182
Sequence length 910
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:47659901:47703014:-1 gene:ENSPTRG00000018241 transcript:ENSPTRT00000057182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGVLWLISFFTFTDGHGGFLGRNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSK
EKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTYCNSLNGVLQCTCEDSYTWFPPSCLDPQ
NCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANG
IEIQLKKAYERIQGFESVQVTQFRNGSIVAGYEVVGSSSASELLSAIEQVAEKAKTALHK
LFPLEDGSFRVFGKAQCNDIVFGFGSKDDEYTLPCSSGYRGNITAKCESSGWQVIRETCV
LSLLEELKKNFSMIVGNATEAAVSSFVQNLSVIIRQNPSTTVGNLASVVSILSNISSLSL
ASHFRVSNSTMEDVISIADNILNSASVTNWTVLLREEKYASSRLLETLENISTLVPPTAL
PLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETII
SMASLTLGNILPISKNGNAQVNGPVISTVIQNYSVNEVFLFFSKIESNLSQPHCVFWDFS
HLQWNDAGCHLVNETQDIVTCRCTHLTSFSMLMSPFVPSTIFPVVKWITYVGLGISIGSL
ILCLIIEALFWKQIKKSQTSHTRRICMVNIALSLLIADVWFIVGATVDTTVNPSGVCTAA
VFFTHFFYLSLFFWMLMLGILLAYRIILVFHHMAQHLMMAVGFCLGYGCPLIISVITIAV
TQPSNTYKRKDVCWLNWSNGSKPLLAFVVPALAIVAVNFVVVLLVLTKLWRPTVGERLSR
DDKATIVRVGKSLLILTPLLGLTWGFGIGTIVDSQNPAWHVIFALLNAFQGFFILCFGIL
LDSKLRQLLFNKLSALSSWKQTEKQNSSDSSAKPKFSKPFNPLQNKGHYAFSHTGDSSDN
IMLTQFVSNE
Download sequence
Identical sequences A0A2J8P0Q7
ENSPTRP00000050031 ENSPTRP00000050031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]