SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050096 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050096
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000359
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000783
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 97-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000050096
Domain Number - Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050096   Gene: ENSPTRG00000018198   Transcript: ENSPTRT00000048101
Sequence length 383
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:44078129:44085484:-1 gene:ENSPTRG00000018198 transcript:ENSPTRT00000048101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCL
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQV
SMLPAGLPLPPDLPPEPGKTTAL
Download sequence
Identical sequences H2R794
9598.ENSPTRP00000050096 ENSPTRP00000050096 XP_003311359.1.37143 XP_003833305.1.60992 XP_003833306.1.60992 XP_016811066.1.37143 XP_518495.2.37143 ENSPTRP00000050096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]