SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050128 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050128
Domain Number 1 Region: 237-566
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.95e-70
Family Pancreatic carboxypeptidases 0.00000204
Further Details:      
 
Domain Number 2 Region: 58-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 3 Region: 566-654
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.96e-19
Family Carboxypeptidase regulatory domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050128   Gene: ENSPTRG00000003027   Transcript: ENSPTRT00000005771
Sequence length 679
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:123239997:123384468:-1 gene:ENSPTRG00000003027 transcript:ENSPTRT00000005771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPKRAPKPKKAPKREKSAPEPPPPGKHSNKKVMRTKSSEKAANDYHSVRVAHEDVRESCP
PLGLETLKITDFQLHASTVKRYGLGAHRGRLNIQAGINENDFYDGAWCAGRNDLQQWIEV
DARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIP
VLNELPVPMVARYIRINPQSWFDNGSICMRMEILGCPLPDPNNYYHRQNEMTTTDDLDFK
HHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISDHPGEHEVGEPEFHYIAG
AHGNEVLGRELLLLLVQFVCQEYLARNARIVHLVEETRIHVLPSLNPDGYEKAYEGGSEL
GGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNVPRKVPNHYIAIPEWFLSENATVAAE
TRAVIAWMEKIPFVLGGNLQGGELVVAYPYDLVRSPWKTQEHTPTPDDHVFRWLAYSYAS
THRLMTDARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYLHTNCFELSIYVGCDKYP
HESQLPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKGIANAIISVEGINHDIRTANDGD
YWRLLNPGEYVVTAKAEGFTASTKNCMVGYDMGATRCDFTLSKTNMARIREIMEKFGKQP
VSLPARRLKLRGRKRRQRG
Download sequence
Identical sequences 9598.ENSPTRP00000050128 ENSPTRP00000050128 ENSPTRP00000050128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]