SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050185 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050185
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 1.33e-27
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 441-546
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000078
Family Galactose-binding domain 0.08
Further Details:      
 
Domain Number 3 Region: 288-394
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000078
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050185   Gene: ENSPTRG00000018126   Transcript: ENSPTRT00000057317
Sequence length 612
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:38682044:39117426:-1 gene:ENSPTRG00000018126 transcript:ENSPTRT00000057317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDW
VRVIDHSQYLCRSWQKLYFPARVCRLVFIGGTHNTVNKIFHIVAFECMFTNKTFTLEKGL
IVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYM
IGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVG
THNTANEVFHCVHFECPEQQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSP
GSNSRSPNRQHQ
Download sequence
Identical sequences ENSPTRP00000050185 ENSPTRP00000050185 ENSGGOP00000002243 ENSGGOP00000002243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]