SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050390 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050390
Domain Number 1 Region: 30-136
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 308-411
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 419-536
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 172-293
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050390   Gene: ENSPTRG00000002823   Transcript: ENSPTRT00000005357
Sequence length 756
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:97736376:97759322:-1 gene:ENSPTRG00000002823 transcript:ENSPTRT00000005357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWSPPATFFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
NFAIQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTKPQ
RKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWSLISASVVCRQLGFGSAREA
LFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWF
WSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQ
LVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT
GRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACAN
FGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCK
YDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI
Download sequence
Identical sequences ENSPTRP00000050390 ENSPTRP00000050390 XP_008949012.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]