SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050488 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050488
Domain Number 1 Region: 295-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-62
Family SPRY domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 28-141
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-22
Family V set domains (antibody variable domain-like) 0.0000849
Further Details:      
 
Domain Number 3 Region: 151-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000396
Family C1 set domains (antibody constant domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050488   Gene: ENSPTRG00000017834   Transcript: ENSPTRT00000057597
Sequence length 494
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26769320:26777675:1 gene:ENSPTRG00000017834 transcript:ENSPTRT00000057597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFPSSGLPRCLLTLILFQLPKLDSAPFDVIGPLEPILAVVGEDAELPCRLSPNASAEH
LELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDG
EYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTS
KGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQEKEVEISIPASSL
PRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKWKKATL
HAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKPERFDSWPCVLGRETFTSGRHYW
EVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
RVGIFLDYESGDISFYNMNDGSDIYTFSNVTVIANAQDLSKEIPLSPMEEDSAPRDADTL
HSKLIPTQPSQGAP
Download sequence
Identical sequences A0A2J8JQP1
ENSPTRP00000050488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]