SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050499 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050499
Domain Number 1 Region: 319-497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-66
Family SPRY domain 0.00000452
Further Details:      
 
Domain Number 2 Region: 34-146
Classification Level Classification E-value
Superfamily Immunoglobulin 4.14e-22
Family V set domains (antibody variable domain-like) 0.00029
Further Details:      
 
Domain Number 3 Region: 160-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000293
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050499   Gene: ENSPTRG00000017829   Transcript: ENSPTRT00000042859
Sequence length 523
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26647293:26661418:1 gene:ENSPTRG00000017829 transcript:ENSPTRT00000042859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPTNPILAMVGENTTLRCHLSPE
KNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSNDINRGSVALVIHNVT
AQENGIYCCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLT
VWRDPYGEVVPTLKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFI
PESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMAVSICCIKKLQREKKILSGEK
KVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPD
NPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL
EMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPV
RPFFRLGSDDSPIFICPALTGANGVMVPEEGLTLHRVGTHQSL
Download sequence
Identical sequences 9598.ENSPTRP00000050499 ENSPTRP00000050499 ENSPTRP00000050499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]