SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050501 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050501
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000778
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 93-213
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-25
Family SH2 domain 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050501   Gene: ENSPTRG00000004601   Transcript: ENSPTRT00000008510
Sequence length 624
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:7122411:7131992:1 gene:ENSPTRG00000004601 transcript:ENSPTRT00000008510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKSLESSAGTVAGSPVRWGGQRGLPVPGPPVLSPDLHQLPVLAP
LHPAADTRRMCMRTCTLRTRGRRK
Download sequence
Identical sequences A0A2J8JEF0
ENSPTRP00000050501 ENSPTRP00000050501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]