SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050620 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050620
Domain Number 1 Region: 31-154
Classification Level Classification E-value
Superfamily L domain-like 1.12e-21
Family U2A'-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050620   Gene: ENSPTRG00000002660   Transcript: ENSPTRT00000057701
Sequence length 226
Comment pep:known chromosome:CHIMP2.1.4:10:74032782:75166061:1 gene:ENSPTRG00000002660 transcript:ENSPTRT00000057701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLVVRGTQVSYIGQDCREIPEHLGRDCGHFAKRLDLSFNLLRSLEGLSAFRSLEELIL
DNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELV
SLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGAFMKVVKPKASSEDVAS
SPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL
Download sequence
Identical sequences H2R7N4
XP_009457024.1.37143 9598.ENSPTRP00000050620 ENSPTRP00000050620 ENSPTRP00000050620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]