SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050715 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050715
Domain Number 1 Region: 602-1029
Classification Level Classification E-value
Superfamily ARM repeat 1.62e-63
Family Armadillo repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 439-661
Classification Level Classification E-value
Superfamily ARM repeat 1.29e-28
Family Armadillo repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 244-309
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.0000127
Family Hypothetical protein c14orf129, hspc210 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050715   Gene: ENSPTRG00000002386   Transcript: ENSPTRT00000004380
Sequence length 1042
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:28213693:28403461:-1 gene:ENSPTRG00000002386 transcript:ENSPTRT00000004380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVALRKLTQWTAAGHGTGILEITPLNEAILKEIIVFVESFIYKHPQEAKFVFVEPLEWN
TSLAPSAFESGYVVSETTVKSEEVDTNGQPLLFLSVPQIKIRSFGQLSRLLLIAKTGKLK
EAQACVEANRDPIVKILGSDYNTMKENSIALNILGKITRDDDPESEIKMKIAMLLKQLDL
HLLNHSLKYISLEISLSPVTVKKDIELLKHFSGKGDQTVLESIEYTSDYEFSNGCAPPWR
QILGECYVLVKPHDGETLCITCSAGGVFLNGGKTDDEGDVNYERKGSIYKNLVTFLREKS
PKFSENMSKQGISFSEDQQKEKDQLGKAPKKEEAAALCKDISGSDKRSLEKNQINFGRNQ
MTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHGRAQLLRKSAEKIEET
VSDSSSESEEDEEPPDHRQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLA
QETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVN
ILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA
RDVEVARCGALALWSCSKSHMNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASE
ENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLIRLHGGLKPLASL
LNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGE
CCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRL
LWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVC
AAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEH
KAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQE
AAAGCISNIRRLALATEKARYT
Download sequence
Identical sequences 9598.ENSPTRP00000050715 ENSPTRP00000050715 ENSPTRP00000050715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]