SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050749 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050749
Domain Number 1 Region: 171-331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-42
Family MAM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 396-562
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-34
Family MAM domain 0.0054
Further Details:      
 
Domain Number 3 Region: 612-771
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-34
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1104-1268
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-30
Family MAM domain 0.00086
Further Details:      
 
Domain Number 5 Region: 2-119
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-19
Family MAM domain 0.019
Further Details:      
 
Domain Number 6 Region: 570-608
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 352-394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1280-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1062-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 10 Region: 1321-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 11 Region: 825-868
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000111
Family MAM domain 0.018
Further Details:      
 
Domain Number 12 Region: 786-825
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number 13 Region: 133-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 14 Region: 922-986
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000316
Family MAM domain 0.0068
Further Details:      
 
Domain Number 15 Region: 1363-1400
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000641
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050749   Gene: ENSPTRG00000029925   Transcript: ENSPTRT00000057812
Sequence length 1492
Comment pep:novel chromosome:CHIMP2.1.4:10:19447421:20023862:1 gene:ENSPTRG00000029925 transcript:ENSPTRT00000057812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRDHSLNTSQGHFMFILKKSSSLWQVAKLQSPTFSQTGPGCILSFWFYNYGLSVGAAELQ
LHMENSHDSTVIWRVLYNQDKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIFE
NCTLPLPAESCEGLDHFWCRHTRACIEKLWLCDLVDDCGDRTDEVNCAPELQRNFETGIC
NWEQDAKDDFDWTRNQGPTPTLNTGPMKDNTLGTAKGHYLYIESSEPQAFQDSAALLSPI
LNATDTKGCTFRFYYHMFGKRIYRLAMYQRIWSDSRGQLLWQIFGNQGNRWIRKHLNISS
RQPFQILVEASVGDGFTGDIAIDDLSFMDCTLYPGNLPADLPTPPETSVPVTLPPHNCTD
NEFVCRSDGHCIEKMQKCDFKYDCPDKSDEASCVMEVCSFEKRSLCKWYQPIPVHLLQDS
NTFRWGLGNGISIHHGEENHRPSVDHTQNTTDGWYLYADSSNGKFGDMADILTPIISLTG
PKCTLVFWTHMNGATVGSLQVLIKKDNVTSKLWAQTGQQGAQWKRAEVFLGIRSHTQIVF
RAKRGISYIGDVAVDDISFQDCSPLLSPERKCTAHEFMCANKHCIAKDKLCDFVNDCADN
SDETTFICRTSRGRCDFEFDLCSWEQEKDEDFDWNLKASSIPAAGTEPAADHTLGNSSGH
YIFIKSLFPRQPMRAARISSPVISKRSKNCKIIFHYHMYGNGIGVLTLMQVSVTNQTKVL
LNLTVEQGNFWRREELSLFGDEDFQLKFEGRVGKGQRGDIALDDIVLTENCLSLHDSVQE
ELAVPLPTGFCPLGYKECQNGKCYRLEQSCNFVDNCGDNTDENECGSSCTFEKGWCGWQN
SQADNFDWVLGVGSHQSLRPPKDHTLGNENAILLMRRHKYPIRSVNVHTVKHVLKAQTVG
NCSVSKLEARLLDFLSVPNENTFGSSDHMNWHFMYLEATPVGLRGDKAHLRSTMWRESSA
ACTMSFWYFISAKATGSIQILIKGGQRRRRAPDPVLSGSPTIPRQGSQQLGGWRSGSARH
RARAFPEPECPRGRSALLQGPPQEEPNRRSALLSVGEISEVCPEITDFLCRDKKCIASHL
LCDYKPDCSDRSDEAHCAQYTSTTGSCNFETSSGNWTTACSLTQDSEDDLDWAIGSRIPA
KALLPDSDHTPGSGQHFLYVNSSGSKEGSVARITTSKSFPASLGMCTVRFWFYMIDPRSM
GILKVYTIEESGLNILVWSVIGNKRMGWTYGYVPLSSNSPFKVAFEADLDGNEDIFIALD
DISFTPECVTGVPVPVQPSPCEADQFSCIYTLQCVPLSGKCDGHEDCIDGSDEMDCPLSP
TPPLCSNMEFPCSTDECIPSLLLCDGVPDCHFNEDELICSNKSCSNGALVCASSNSCIPA
HQRCDGFANCMDFQLDESSCSDTWTLLGIGLAFLMTHITVAVLGFLANRKVPIRKIERSG
NCAFVSPVYGNWSNPEKTESSVYSFSNPLYGTTSGSLETLSHHLKQQHRDQV
Download sequence
Identical sequences ENSPTRP00000050749 ENSPTRP00000050749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]