SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050767 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050767
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily L domain-like 2.49e-29
Family Ngr ectodomain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050767   Gene: ENSPTRG00000040912   Transcript: ENSPTRT00000057831
Sequence length 147
Comment pep:novel chromosome:CHIMP2.1.4:10:42561898:42572075:1 gene:ENSPTRG00000040912 transcript:ENSPTRT00000057831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPPNIAELKNLEVLNFLNNQIEKLPTQISRLQKLKHLNLGMNRLNISPQGFGSLPALEV
LDLTYNNLNENYLPGNFFYLTTLCALYLSDNNFEILPPDIGKLTKLQILSNRDNNLISLP
KEIRVLIQLKELHIQGNCLTVLPPELG
Download sequence
Identical sequences ENSPTRP00000050767 ENSPTRP00000050767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]