SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050882 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050882
Domain Number 1 Region: 49-423
Classification Level Classification E-value
Superfamily L domain-like 1.76e-66
Family Ngr ectodomain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050882   Gene: ENSPTRG00000030017   Transcript: ENSPTRT00000057947
Sequence length 545
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:198473048:198474685:-1 gene:ENSPTRG00000030017 transcript:ENSPTRT00000057947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGAWLLWTSLLLLARPAQPCPVGCDCFVQEVFCSDEELATVPLDIPPYAKNIIFVETS
FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNL
TSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNL
LAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQL
FCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQ
LETVAEGAFAHLSNLHSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALFQNL
SKLELLSLSKNQLTTLPEGIFDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNI
QTYCAGPAYLKGQVVPALNEKQLVCPITRDRLGFQVTWLDESKAGGSWDLAVQERAARSQ
CTYSNPEGTVVLACDQAQCRWLNVQLSPRQGSLGLQYNASQEWDLRSSCGSLRLTVSIEA
RAAGP
Download sequence
Identical sequences H2R7V5
ENSPTRP00000050882 9598.ENSPTRP00000050882 ENSPTRP00000050882 XP_001162714.1.37143 XP_009445319.1.37143 XP_009445320.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]