SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050972 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000050972
Domain Number - Region: 166-204
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0314
Family Troponin I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050972   Gene: ENSPTRG00000015575   Transcript: ENSPTRT00000058034
Sequence length 244
Comment pep:known chromosome:CHIMP2.1.4:3:163614284:163671986:1 gene:ENSPTRG00000015575 transcript:ENSPTRT00000058034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHQDNCSYQAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQIC
FVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKK
LQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMT
IGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEK
MPAK
Download sequence
Identical sequences A0A1D5QDS8 A0A2I3G9M0 A0A2I3MPW1 A0A2K5J8W3 A0A2K5L2D5 A0A2K5QXY5 A0A2K5W6T4 A0A2K5YC56 A0A2K6D9G9 A0A2K6KCW5 A0A2K6QCD4 G3RZX6 H2R7Y7
ENSP00000404860 ENSP00000404860 gi|308193348|ref|NP_001184038.1| ENSPTRP00000050972 ENSPTRP00000050972 NP_001184038.1.87134 NP_001184038.1.92137 NP_001229984.1.37143 XP_003256410.1.23891 XP_004037970.1.27298 XP_005546299.1.63531 XP_008006748.1.81039 XP_009237755.1.23681 XP_011751033.1.29376 XP_011814448.1.43180 XP_011852943.1.47321 XP_011942510.1.92194 XP_017356258.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]