SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050998 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050998
Domain Number 1 Region: 10-180,282-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.02e-48
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050998   Gene: ENSPTRG00000002164   Transcript: ENSPTRT00000058058
Sequence length 486
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:220885328:220945450:1 gene:ENSPTRG00000002164 transcript:ENSPTRT00000058058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDSRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTNSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMDKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHLKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRPFLRLRRPWNWIAHFWNTTCFPAKAMDSLEQI
SNLISR
Download sequence
Identical sequences A0A2I3RF66
XP_001160394.2.37143 ENSPTRP00000050998 ENSPTRP00000050998 9598.ENSPTRP00000050998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]