SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051017 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051017
Domain Number 1 Region: 2202-2380,2412-2548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 559-1065,1121-1350
Classification Level Classification E-value
Superfamily ARM repeat 2.26e-45
Family HEAT repeat 0.032
Further Details:      
 
Domain Number 3 Region: 1690-1714,1891-1968
Classification Level Classification E-value
Superfamily TPR-like 0.00000963
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000051017
Domain Number - Region: 35-367
Classification Level Classification E-value
Superfamily ARM repeat 0.0107
Family HspBP1 domain 0.048
Further Details:      
 
Domain Number - Region: 1624-1650,1681-1793
Classification Level Classification E-value
Superfamily TPR-like 0.0266
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051017   Gene: ENSPTRG00000015483   Transcript: ENSPTRT00000058073
Sequence length 2625
Comment pep:known chromosome:CHIMP2.1.4:3:146025528:146148661:-1 gene:ENSPTRG00000015483 transcript:ENSPTRT00000058073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTDSQPTSVMLLDFIQHIMKSS
PLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLHKKICEVICSLLFLFKSKSP
AIFGVLTKELLQLFEDLVYLHRRNVMSHAVEWPVVMSRFLSQLDEHMGYLQSAPLQLMSM
QNLEFIEVTLLTVLTRIIAIVFFRRQELLLWQIGCVLLEYGSPKIKSLAISFLTELFQLG
GLPAQPASTFFSSLLELLKHLVEMDTDQLKLYEEPLSKLIKTLFPFEAEAYRNIEPVYLN
MLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAGYESALQVRKVYVRNICKAL
LDVLGIQVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLN
PSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQL
TALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKPDL
EATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFATNLLT
LSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWALQSSHEVIRASCVSGFFILL
QQQNSCNRVPRILIDKVKDDSDIVKKEFASILGQLVCTLHGMFYLTSSLTEPFSEHGHVD
LFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKTPSPVKLAFIDNLHHLCKHLDFREDE
TDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDGFIKELFVLRMKEAYTHAQI
SRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKSASVSGAAYTEIRALVAAKS
VKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADMRKQDVAHQREMALNTLSEIA
NVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQLNVNRREILINNFKYIFSH
LVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELLLRIGEHYQQVFNGLSILAS
FASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALNSLMSLM
KLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFVRCLDHGCLGSLLSHVIVAL
LPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPELKKIKAVLQEYRKETSEST
DLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIKYATDSETVEPIISQLVTVL
LKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKDFTFVTGVEDSSFAYGLLME
LTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLN
TRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLITKVRHDLASKIFTCCSIMMK
HDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDDQHTINTQDIASDLCQLSTQ
TVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVSTVDYEDYQSVTRFLDLIPQD
TLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLYAAMHEPDGVAGVSAIRKAE
PSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLGLGQLSTVITQVNGV
HANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLGQLLLSAKKRDITAF
YDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCELEHSIKPLFQHSPGDSSQED
SLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWLQSARVARKAGHHQT
AYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFPENETPPEGKNMLIH
GRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHFYLAKYYDKLMPMVTDNKME
KQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTKAYEWEKAGRSDRVQMRNDL
GKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLAYPQQAMWMM
TAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTDKLLELCNKPVDGSSSTLSM
STHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIAGFDDM
VEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRE
LHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELRQCMLPKSAALSE
KLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGE
NILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVT
MRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRL
QGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Download sequence
Identical sequences ENSPTRP00000051017 ENSPTRP00000051017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]