SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pan troglodytes 76_2.1.4 > ENSPTRP00000051252

Domain assignment for ENSPTRP00000051252 from Pan troglodytes 76_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPTRP00000051252
Domain Number 1	Region: 74-245
Classification Level	Classification	E-value
Superfamily	E set domains	1.33e-34
Family	Arrestin/Vps26-like	0.014
Further Details:

Domain Number 2	Region: 5-75
Classification Level	Classification	E-value
Superfamily	E set domains	0.0000000000273
Family	Arrestin/Vps26-like	0.018
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPTRP00000051252 Gene: ENSPTRG00000007487 Transcript: ENSPTRT00000013800
Sequence length	316
Comment	pep:known_by_projection chromosome:CHIMP2.1.4:15:95432690:95444116:1 gene:ENSPTRG00000007487 transcript:ENSPTRT00000013800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEGIILLQPGKHEFPFRFQLPSEPLVTSFTGKYGSIQYCVRAVLERPKVPDQSVKRELQV VSHVDVNTPALLTPVLKTQEKMVGCWFFTSGPVSLSAKIERKGYCNGEAIPIYAEIENCS SRLIVPKAAIFQTQTYLASGKTKTIRHMVANVRGNHIASGSTDTWNGKTLKIPPVTPSIL DCCIIRVDYSLAVYIHIPGAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLT LPEQPEAPPNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVD PHPSDVEETQPVSFIL
Download sequence
Identical sequences	ENSPTRP00000051252 9598.ENSPTRP00000051252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]