SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051702 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051702
Domain Number 1 Region: 88-191
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-26
Family SH2 domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051702   Gene: ENSPTRG00000001476   Transcript: ENSPTRT00000002712
Sequence length 389
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:135105954:135116940:-1 gene:ENSPTRG00000001476 transcript:ENSPTRT00000002712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVR
FSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLRHYTAHPLSPYGE
TLTEPLARQTPEPAGLFLRTEESNFGSKSQDPNPQYSPIIKQGQALVPMQKEGAGEKEPS
QLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEA
PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPP
AWRHTLPHNLSRQVLQERGQAWLPLGPPQ
Download sequence
Identical sequences ENSPTRP00000051702 ENSPTRP00000051702 XP_001167540.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]