SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051735 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051735
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 6.29e-64
Family Phosphotyrosine-binding domain (PTB) 0.0000000059
Further Details:      
 
Domain Number 2 Region: 472-577
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-28
Family SH2 domain 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051735   Gene: ENSPTRG00000001397   Transcript: ENSPTRT00000058703
Sequence length 584
Comment pep:known chromosome:CHIMP2.1.4:1:133218989:133227247:-1 gene:ENSPTRG00000001397 transcript:ENSPTRT00000058703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPAGR
ELFDDPSYVNVQNLDKARQAVGGAGPPNPAVNGSVPRDLFDMKPFEDALRVPPPPQSVSM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences H2R8L2
ENSPTRP00000051735 XP_008968525.1.60992 XP_009431127.1.37143 ENSPTRP00000051735 9598.ENSPTRP00000051735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]