SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051866 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051866
Domain Number 1 Region: 51-125
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000332
Family SH2 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051866   Gene: ENSPTRG00000012133   Transcript: ENSPTRT00000058818
Sequence length 143
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:86618293:86624519:1 gene:ENSPTRG00000012133 transcript:ENSPTRT00000058818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGPLPRTSMMPRPTTAPQETRNGAADAASKEGRKSSVPSVAPTGSTSAAEDGAYTVRP
SSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNHEELFSSVAAMVQHFMWH
PLPLVDRHSGSRELTCLLFPTKP
Download sequence
Identical sequences H2R8R0
XP_008967879.1.60992 ENSPTRP00000051866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]