SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051884 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051884
Domain Number 1 Region: 3-381
Classification Level Classification E-value
Superfamily L domain-like 4.93e-63
Family Internalin LRR domain 0.066
Further Details:      
 
Domain Number 2 Region: 587-682
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 502-598
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-20
Family I set domains 0.0093
Further Details:      
 
Domain Number 4 Region: 395-504
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-18
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051884   Gene: ENSPTRG00000001120   Transcript: ENSPTRT00000002099
Sequence length 888
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:123675151:123705965:-1 gene:ENSPTRG00000001120 transcript:ENSPTRT00000002099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMNYNELTEIPYFGEPTSNITLLSLVHNIIPEINAQALQFYPALGSLDLSSNIISEIKTS
SFPRMQLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRISMIPPKIFKLPHLQFLEL
KRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGW
LYGLQMLQQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNL
GDNRVTHIADGVFRFLSNLQTLDLRNNEISWAIEDANEAFAGLTSLTKLILQGNQIKSIT
KKAFIGLESLEHLDLNNNAIMSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNN
FQHSVNVSCAHPEWLAGQSILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAV
SSSDSPMSTVWRKDSEILYDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIV
TNHFGSNYSQKAKLTVNEMPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTD
FPAARERRMHVMPEDDVFFIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPL
EDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAG
KYTCIMSNTLGTERGHIYLNVISSPNCDSSQSSIGHEDDGWTTVGVVIIVVVCCVVGTSL
IWVIVIYHMRRKNEDYSITNTEELNLPADIPSYLSSQGTLSQPQEGYSNSEAGSHQQLMP
PANGYIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMP
KETYLVHPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTQMSG
Download sequence
Identical sequences ENSPTRP00000051884 ENSPTRP00000051884 9598.ENSPTRP00000051884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]