SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051920 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051920
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily F-box domain 5.61e-21
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051920   Gene: ENSPTRG00000030457   Transcript: ENSPTRT00000058862
Sequence length 155
Comment pep:known chromosome:CHIMP2.1.4:2A:69364863:69370204:-1 gene:ENSPTRG00000030457 transcript:ENSPTRT00000058862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKNSKRNNNSGVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASL
TCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLS
GRYSNICSPISLPEKIMYPMDADTWGEILEAELER
Download sequence
Identical sequences H2R8S4
9598.ENSPTRP00000051920 XP_001167525.1.37143 XP_003830965.1.60992 XP_008954579.1.60992 XP_009440859.1.37143 XP_016804157.1.37143 ENSPTRP00000051920 ENSPTRP00000051920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]