SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052042 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052042
Domain Number 1 Region: 483-684
Classification Level Classification E-value
Superfamily vWA-like 2.5e-53
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 305-488
Classification Level Classification E-value
Superfamily vWA-like 6.12e-44
Family Integrin A (or I) domain 0.00068
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily LCCL domain 3.01e-30
Family LCCL domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052042   Gene: ENSPTRG00000030515   Transcript: ENSPTRT00000058976
Sequence length 691
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:37226659:37342404:1 gene:ENSPTRG00000030515 transcript:ENSPTRT00000058976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVVLTMKASVIEMFLVLLLTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIINPEFIV
KCPAGCQDPKYHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNG
VQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGETTKAYQRPPIPGTTAQ
PVTLMQLLAVTVAVATPTTLPRPSPSAASTTSIPRPQSVGHRSQEMDLWSTATYTSSQNR
PGADPGTQRQDPSGAAFQKPVGADVSLGEMDSWKPGSVLLDEGLVPKEDLSTQSLEPVSL
GDPNCKIDLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHF
NLKTHTNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVLVDGW
PTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNFYSLHVQSWFG
LQDLQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEI
SDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFK
KSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDH
SFFVDEFDNLYQYVPRIIQNICTEFNSQPRN
Download sequence
Identical sequences ENSPTRP00000052042 ENSPTRP00000052042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]