SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052236 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052236
Domain Number 1 Region: 443-733
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.76e-76
Family Protein kinases, catalytic subunit 0.0000003
Further Details:      
 
Domain Number 2 Region: 287-370
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 38-130
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052236
Domain Number - Region: 146-233
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00275
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052236   Gene: ENSPTRG00000024245   Transcript: ENSPTRT00000049002
Sequence length 913
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:64364135:64773828:1 gene:ENSPTRG00000024245 transcript:ENSPTRT00000049002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARGCSDTELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGN
PPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTG
VLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA
AFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEY
IFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGT
VSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSD
LCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIALLFFFICVCRNNQKSSSAPVQRQPK
HVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVA
IKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYINQGDLHEFL
IMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIG
EQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWE
IFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHV
RLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAG
FIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTGPPRVIQHCPPPKSRSPSSASGSTS
TGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGITVFGNKSQKPYKIDSKQASLLGDAN
IHGHTESMISAEL
Download sequence
Identical sequences ENSPTRP00000052236 ENSPTRP00000052236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]