SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052470 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052470
Domain Number 1 Region: 161-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000241
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 2 Region: 41-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000425
Family V set domains (antibody variable domain-like) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052470   Gene: ENSPTRG00000013165   Transcript: ENSPTRT00000059339
Sequence length 342
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:1387427:1404982:-1 gene:ENSPTRG00000013165 transcript:ENSPTRT00000059339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTMSAPTCLAHLPPCFLLLALVLVPSDASGQSSRNDWQVLQPEGPMLVAEGETLLLRC
MVVGSCTDGMIKWVKVSTQDQQEIYNFKHGSFPGVMPMIQRTSEPLNCDYSIYIHNVTRE
HTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNC
TVLGDGPPGPIRWFQGAGLSREAIYNFGGISHPKATAVQASNNDFSILLQNVSSEDAGTY
YCVKFQRKPNRQYLSGQGTRLKVKAKSTSSKEAEFTSEPATEMYPTGLLVVFAPVVLGLK
AITLAALLLALATSRRSPGQEDVKTTGPAGAMNTLAWSKGQE
Download sequence
Identical sequences H2R962
ENSPTRP00000052470 XP_003821316.1.60992 XP_016792792.1.37143 9598.ENSPTRP00000052470 ENSPTRP00000052470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]