SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052472 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052472
Domain Number 1 Region: 253-368
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-34
Family UBX domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 174-269
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.24e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000306
Family TAP-C domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052472   Gene: ENSPTRG00000013164   Transcript: ENSPTRT00000059341
Sequence length 370
Comment pep:known chromosome:CHIMP2.1.4:20:1354737:1380308:-1 gene:ENSPTRG00000013164 transcript:ENSPTRT00000059341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
LNAVIVQRLT
Download sequence
Identical sequences A0A2J8VI81 A0A2K5QJL6 G3SJI5 H2R963 Q5RBG3 Q9UNZ2
ENSP00000216879 ENSPPYP00000012121 ENSP00000216879 NP_001125510.1.23681 NP_057227.2.87134 NP_057227.2.92137 XP_001154255.1.37143 XP_004061716.1.27298 XP_017371066.1.71028 ENSPTRP00000052472 9600.ENSPPYP00000012121 9606.ENSP00000216879 ENSPTRP00000052472 ENSPPYP00000012121 gi|20149635|ref|NP_057227.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]