SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052649 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052649
Domain Number 1 Region: 573-639
Classification Level Classification E-value
Superfamily F-box domain 0.000000314
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052649   Gene: ENSPTRG00000006373   Transcript: ENSPTRT00000011674
Sequence length 711
Comment pep:known chromosome:CHIMP2.1.4:14:54245318:54327690:1 gene:ENSPTRG00000006373 transcript:ENSPTRT00000011674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITPSVFPSASLGKASSRK
PFGILSPNVLCSMSGKSPVESSLNVKTKKNAPSATIHQGEEEGPLDIWAVVKPGNTKEKI
AFFASHQCSNRIGSMKIKSSWDIDGRATKRRKKSGDLKKAKVQVERMREVNSRCYQPEPF
ACGIEHCSVHYVSDSGDGVYAGRPLSVIQMVAFLEQRASALLASCSKNCTNSPAIVRFSG
QSRGVPAVSESYSAPGACEEPTERGNLEVGEPQSEPVRVLDMVAKLESECLKRQGQREPG
SLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAPDTQVNPVGSVSVDCGPSRADRCSP
KEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVEMTDELVGLPFSSHT
YSQASELPTNAVDCMSRELVSLTSQNPDQRKESLCISITVSKVDKDQPSNLNSCEDPVPG
MLFFLPPGQHLSDYSQLNESTTKESSEASQLEDAAGGDSASEEKSGSAEPFVPPASSVES
TLPVLEASSWKKQVSHDFLETRFKIQQLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKC
TCCYFKFIIEYYNIRPADSRWVRDPRYREDPCKQCKKKYVKGDVSLCRWHPKPYCQALPY
GPGYWMCCHRSQKGFPGCKLGLHDNHWVPACHSFNRAIHKKAKGTEAEEEY
Download sequence
Identical sequences K7CMQ0
9598.ENSPTRP00000052649 ENSPTRP00000052649 ENSPTRP00000052649 XP_008955289.1.60992 XP_008955290.1.60992 XP_008955291.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]