SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052704 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052704
Domain Number 1 Region: 592-893
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-76
Family Ephrin receptor ligand binding domain 0.0000000125
Further Details:      
 
Domain Number 3 Region: 303-508
Classification Level Classification E-value
Superfamily Fibronectin type III 5.62e-41
Family Fibronectin type III 0.0000216
Further Details:      
 
Domain Number 4 Region: 889-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 232-303,341-360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000359
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052704   Gene: ENSPTRG00000000320   Transcript: ENSPTRT00000043268
Sequence length 1034
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:22787748:22919881:1 gene:ENSPTRG00000000320 transcript:ENSPTRT00000043268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRR
GAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTI
AADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRII
QNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFE
AVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPC
TTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQY
APRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSI
MHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAG
AIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVI
AIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCV
KIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPN
VIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMN
YVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYR
KFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLD
CWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEW
LEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQI
QSVEGQPLARRPRATGRTKRRQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFK
EDSHKESNDCSCGG
Download sequence
Identical sequences 9598.ENSPTRP00000052704 ENSPTRP00000052704 ENSPTRP00000052704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]