SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052863 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052863
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-74
Family F-box associated region, FBA 0.00000197
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052863   Gene: ENSPTRG00000000147   Transcript: ENSPTRT00000000334
Sequence length 255
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:11798940:11806690:1 gene:ENSPTRG00000000147 transcript:ENSPTRT00000000334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKGEDLSRDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences ENSPTRP00000052863 ENSPTRP00000052863 9598.ENSPTRP00000052863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]