SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052915 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052915
Domain Number 1 Region: 42-244
Classification Level Classification E-value
Superfamily L domain-like 4.42e-37
Family Ngr ectodomain-like 0.069
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052915
Domain Number - Region: 445-493
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0497
Family B3/B4 domain of PheRS, PheT 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052915   Gene: ENSPTRG00000000068   Transcript: ENSPTRT00000000149
Sequence length 583
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:3588806:3606135:-1 gene:ENSPTRG00000000068 transcript:ENSPTRT00000000149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVSESWPELELAERERRRELLLTGPGLEERVRAAGGQLPPRLFTLPLLHYLEVSGC
GSLRAPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGL
GPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPL
LSELAAADNCLRELSPDIAHLASLKTLDLSNNQLNEIPAELADCPKLKEINFRGNKLRDK
RLEKMVSGCQTRSILEYLRVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQD
VGDAGRLLLRVLHVSENPAPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQT
KLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEA
EEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTFDLF
LEVTSATSLQICKDVMDALILKMAEMNKYTLENKEEGSLSDTEADAVSGQLPDPRTNPSA
GKDGPSLLVVEQVRVVDLEGSLKVVYPSKADLATAPPHVTVVR
Download sequence
Identical sequences 9598.ENSPTRP00000052915 ENSPTRP00000052915 ENSPTRP00000052915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]