SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053032 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053032
Domain Number 1 Region: 37-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000301
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053032   Gene: ENSPTRG00000030923   Transcript: ENSPTRT00000059793
Sequence length 452
Comment pep:known chromosome:CHIMP2.1.4:17:18426549:18453695:1 gene:ENSPTRG00000030923 transcript:ENSPTRT00000059793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRINTNFTLIPNQKLRRSNRQSSCYSKTLGSGFQPISTFGNFKALPLEIFQIILKYLS
VKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNLELPDRRQDSAILEHYRSLGLL
FKRCTLLLPTKERLKYIHKILTEVSCFKFNGCAAPMQCLGLTCYGMFLQTLTAGWDELEC
HRVYNFLCELTNLCRKMQMAVCSKPGSARKLELRIRLFCRNVLLDHWTHRSDSAFWLTRI
LKPWPMVNQARLLYIIFGPISPQDGQVVWQEMIEEPTDEFSLKGLADAIKLLYDASTKEW
TADDVISLVDELSVVPREWLLENNARLLMLSGNNICFSFMASKAVNGRTIELARLVVFLA
LVCEKELYCMDWTVKMMQKVCKVFSTPVERKNFLQNVANAFACVIMEMLQSIMSGDRDED
DRSFLNLFHLVHAQANFHKEVLYLTMNTPLST
Download sequence
Identical sequences H2R9N4
NP_001234939.1.37143 XP_003809886.1.60992 XP_016786155.1.37143 9598.ENSPTRP00000053032 ENSPTRP00000053032 ENSPTRP00000053032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]