SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053040 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053040
Domain Number 1 Region: 62-179
Classification Level Classification E-value
Superfamily L domain-like 1.02e-25
Family Ngr ectodomain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053040   Gene: ENSPTRG00000030925   Transcript: ENSPTRT00000059800
Sequence length 275
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:17438839:17442102:-1 gene:ENSPTRG00000030925 transcript:ENSPTRT00000059800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLSLLLVIGTGGTVPSPQVPPRGCYVAKEAGE
RTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHNALAHLSG
AAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPG
TGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLVVAYL
VHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Download sequence
Identical sequences H2R9N7
ENSPTRP00000053040 XP_003831489.1.60992 ENSPTRP00000053040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]