SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053097 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053097
Domain Number 1 Region: 628-682
Classification Level Classification E-value
Superfamily RING/U-box 0.0000138
Family RING finger domain, C3HC4 0.065
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000053097
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily F-box domain 0.000458
Family F-box domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053097   Gene: ENSPTRG00000020469   Transcript: ENSPTRT00000059848
Sequence length 708
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:98407358:98419879:-1 gene:ENSPTRG00000020469 transcript:ENSPTRT00000059848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFKDKDERISCLEAYVTFTSKSSRFTDETEILKMSQRHSGQAGTEAGNGADSPPIVNSK
YSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLE
SPTQKKKCILPRKEKDKTPELCETPKISGKKCLPRRRLNVSFALLKGDFESQNSSLESSI
SQVINLEKNIPSSASGFPRANNFSPLVTSTLKTEEVTSCSQKLRLNFSQQKTSTIDDSKD
DCSLFEVECISPIQGNNFKDSITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFV
TPISNLVANIRFNASQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGSFQELLQ
KHKGTPKVGDTIRKTRHLGRSRRLSTLREQSSQSETEEEKQIVHPDSEKRAAAASAISEG
QLSSDESGDLTFSLKNLSKTPALQLVHELFMKSKRKRLQENSGHEFLEQGDGEKIAVLQC
ILAGLIGKKMGIEKLDILTELKYRNLKHILAMVLESLTAESLCSVWKVSRNWREIVVQDK
NANRRRKFYITQLKTDSEGAVLNVEDAATRLQLLNRSALRSVQAQARIPGSQREQGSTLS
PWGEVLTPLASSSVTHLSSKQEEYVKVAKTLFTDEALKPCPRCQSPAKYQPYKKRGLCSR
TACGFDFCVLCLCAYHGSEECSRGAAKPRNRKDALPGSAQSKRNLKRL
Download sequence
Identical sequences H2R9R4
ENSPTRP00000053097 XP_001151379.2.37143 ENSPTRP00000053097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]