SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053360 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053360
Domain Number 1 Region: 72-123
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000102
Family beta-sandwich domain of Sec23/24 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000053360
Domain Number - Region: 234-298
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0183
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053360   Gene: ENSPTRG00000031125   Transcript: ENSPTRT00000060071
Sequence length 457
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:107526749:108224338:-1 gene:ENSPTRG00000031125 transcript:ENSPTRT00000060071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRARDKEHQQQQRQQQQQQQQQRQRQQQQQRRQQEPSWPALLASMGESSPAAQAHR
LLSASSSPTLPPSPGDGGGGGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQC
FTVENADAVCARNWSRGAAGGDGQEVRSKHPTPLWNLSDFYLSFCNSYTLWELFSGLSSP
NTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSCP
EDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFIC
TGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLCV
LVLILLHTVLTASAAQNTTGLSFGGINTLEENSTNEE
Download sequence
Identical sequences H2RA00
XP_509725.2.37143 9598.ENSPTRP00000053360 ENSPTRP00000053360 ENSPTRP00000053360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]