SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053587 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053587
Domain Number 1 Region: 81-92,121-192,240-424
Classification Level Classification E-value
Superfamily ARM repeat 0.000000062
Family Armadillo repeat 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053587   Gene: ENSPTRG00000031215   Transcript: ENSPTRT00000060258
Sequence length 593
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:31628289:31637748:1 gene:ENSPTRG00000031215 transcript:ENSPTRT00000060258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLGAGVRLFTGVYPVVLNQIRATSEASAITRTTAQLAAAAGALGGEKDPATNETPLSR
ALLALRTRHIKAAGGIERFRARGGLRPLLALLRRAAAAGSAPSQAGPGSAPSSAASAASS
PAPASGPAPSAVSSSSPTPPVRLRKTLDLALSILADCCTEGACRTEVRRLGGILPLSWLI
SEGYATGPDDISPDWSPEQCPPEPMEPASPAPTPTSLRAPRTQRTPGRSPAAAIEEPWGR
EGPALLLLSRFSQAPDPSGALVTGPALYGLLTYVTGAPGPPSPRALRILSRLTCNPACLE
AFVRSYGAALLRAWLVLGVAPDDWPAPRARPTLHSRHRELGERLLQNLTVQAESPFGVGA
LTHLLLSGSPEDRVACALTLPFICRKPSLWRRLLLEQGGLRLLLAALTRPAPHPLFLFFA
ADSLSCLQDLVSPTVSPAVPQAVPMNLDSPSPCLYDPLLGPAPVPAHGCRGCGALGPVPP
PGQPLLGSEAEEALEAAGRFLLPGLEEELEEAVGRIHLGPQGGPESVGEVFRLGRPRLAA
HCARWTLGSEQCPRKRGLALVGLVEAAGEEAGPLTEALLAVVMGIELGARVPA
Download sequence
Identical sequences ENSPTRP00000053587 ENSPTRP00000053587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]