SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053745 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053745
Domain Number 1 Region: 244-350
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000664
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053745   Gene: ENSPTRG00000015849   Transcript: ENSPTRT00000042668
Sequence length 356
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:2707871:2895306:1 gene:ENSPTRG00000015849 transcript:ENSPTRT00000042668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPPLPTPGLPALLKQGWARKGRRKHPPRLLPPPPXXXDPPDVGLAAEDKRDTLCPRRAE
PCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMAT
ATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFLKTAEEDPPREAAMPGLFVPPVAPRP
PVLKLPVPEAMARPAVLPRPEKLQLPHLQRSPPDGQSFRSFSFEKPRQPSQADAGGDDSD
EDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETS
NKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR
Download sequence
Identical sequences ENSPTRP00000053745 ENSPTRP00000053745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]