SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053819 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000053819
Domain Number - Region: 483-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053819   Gene: ENSPTRG00000007540   Transcript: ENSPTRT00000013897
Sequence length 757
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:375639:508619:-1 gene:ENSPTRG00000007540 transcript:ENSPTRT00000013897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVAGPLLLRILENGQPPSPGSSLHKKVGLVSEHFSQAPQRLSFYSWYGSARLFRFRVPP
DAVLLRWLLQVSRESGAACTDAEITVHFRSGAPPVINPLGTSFPDDTAVQPSFQVGVPLS
AAPRSNASVNVSHPAPGDWFVAAHLPPSSQKIELKGLAPTCAYVFQPELLVTRVVEISIM
EPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQK
VLTCTGAPWPCRLLLPSPPWDRWLQVTAESLVGPLGTVAFSAVAALTACRPRSVTVQPLL
QSSQNQSFNASSGLLSPSPDHQDLGRSGRVDRSPFCLTNYPVMREDTDVVSVHFQPLDRV
SVRVCSDTPSVMRLRLNTGMDSGGSLTISLRANKTEMRNETVIVACVNAASPFLGFNISL
NCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLY
LVPCLNDCGPYGQCLLLRRHSYLYASCSCKAGWRGWSCTDNSTAQTVAQQRAATLLLTLS
NLMFLAPIAVSVRRFFLVEASVYAYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGS
GVAIWVTILCMARLKTVLKYVLFLLGTLVIAMSLQLDRRGMWNMLGPCLFAFVIMASMWA
YRCGHRRQCYPTSWQRWAFYLLPGVSMASVGIAIYTSMMTSDNYYYTHSIWHILLAGSAA
LLLPPPDQPAEPWACSQKFPCHYQICKNDREELYAVT
Download sequence
Identical sequences ENSPTRP00000053819 ENSPTRP00000053819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]