SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053920 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053920
Domain Number 1 Region: 1578-1749
Classification Level Classification E-value
Superfamily C-type lectin-like 1.51e-72
Family Endostatin 0.0000000274
Further Details:      
 
Domain Number 2 Region: 456-652
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-34
Family Trypanosoma sialidase, C-terminal domain 0.071
Further Details:      
 
Domain Number 3 Region: 332-446
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.59e-28
Family Frizzled cysteine-rich domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053920   Gene: ENSPTRG00000014005   Transcript: ENSPTRT00000046373
Sequence length 1754
Comment pep:known_by_projection chromosome:CHIMP2.1.4:21:31469287:31531100:1 gene:ENSPTRG00000014005 transcript:ENSPTRT00000046373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYPCGCHILLLLFCCLAAARADLLNLNWLWFSNEDTSHAATTIPEPQGPLPVQPTADT
TTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKG
IRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRDIPSSLGA
HTTEAGTLPAPTPSPPSLGRPWAPLTGPSVPPPSSGRASLSSLLGGAPPWGSLQDPDSQG
LSPAAAAPSQQLQRPDVRLRTPLLHPLVTGSLGKHAAPSAFSSGLPGALSQVAVTTLIRD
SGAWVSHVANSVGPGLANNSALLGADPEAPAGRCLPLPPSLPVCGRLGISHFWLPNHLHH
ESGEQVRAGARAWGGLLRTHCHPFLAWFFCLLLAPPCGSVPPPAPPPCRQFCEALQDACW
SRLGGGRLPVACASLPTQEDGYCVFIGPAAERVSEEVGLLQLLGDPPPQQVTQTDDPDVG
LAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAVVLLGVKL
SGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQR
MPLARSSQGLELEPGAGLFVAQAGGADPDKFQGVIAELKVRRDPQVSPMHCLDEEGDDSD
GASGDSGSGLGDTRELLREETGVALKPRLPTPPPVTTPPLAGGSSTEDSRSEEIEEQTTV
ASLGAQTLPGSDSVSTWDGSVRTPGGRVKEGGLKGQKGEPGVPGPPGRAGPPGSPCLPRP
PGLPCPVSPLGPAGPALQPVPGPQGPPGPPGRDGTPGRDGEPGDPGEDGKPGDTGPQGFP
GTPGDVGPKGDKGDPGVGERGPPGPQGPPGPPGPSFRHDKLTFIDMEGSGFGGDLEALRG
PRGFPGPPGPPGVPGLPGEPGRFGVNSSDVPGPAGLPGVPGREGPPGFPGLPGPPGPPGR
EGPPGRTGQKGSLGEAGAPGHKGSKGDPGPAGARGESGLAGAPGPAGPPGPPGPPGPPGP
GLPAGFDDMEGSGGPFWSTARSAAGPQGPPGLPGLKGDPGVPGLPGAKGEVGADGVPGFP
GLPGREGIAGPQGPKGDRGSQGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDGSVLSV
PGPEGRPGFAGFPGPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSSDGGALGPAQKGAKG
EPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGLKGEKGEPGDASLGFGMRGMPGPPGPP
GPPGPPGTPVYDSNVFAESSRPGPPGLPGNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLE
AEMKGEKGDRGDAGQKGERGEPGGGGFFSSSLPGPPGPPGPRGYPGIPGPKGESIRGQPG
PPGPQGPPGIGYEGRQGPPGPPGPPGPPGPPSFPGPHRQTISVPGPPGPPGPPGPPGTMG
ASSGVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVRNGFRKVQLEARTPLPRGTDN
EVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVH
LRPARPTSPPAHTHRDFQPVLHLVALNSPLSGSMRGIRGADFQCFQQARAVGLAGTFRAF
LSSRLQDLYSIVRRADRTAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVL
RHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAVSCHHAY
IVLCIENSFMTASK
Download sequence
Identical sequences ENSPTRP00000053920 ENSPTRP00000053920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]