SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054056 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054056
Domain Number 1 Region: 95-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-18
Family Complement control module/SCR domain 0.0000958
Further Details:      
 
Domain Number 2 Region: 382-454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-17
Family Complement control module/SCR domain 0.0000348
Further Details:      
 
Domain Number 3 Region: 156-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0000214
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.33e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 443-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 6 Region: 231-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000944
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 35-97
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000526
Family Complement control module/SCR domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054056   Gene: ENSPTRG00000041105   Transcript: ENSPTRT00000061520
Sequence length 539
Comment pep:novel chromosome:CHIMP2.1.4:1:186726469:186803480:1 gene:ENSPTRG00000041105 transcript:ENSPTRT00000061520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPVRIERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDEFEFPIGTY
LNYECRPGYYGRPFSIICLKNSVWTSAEDKCKRKSCRNPPDPVNGMVHVIKDIQFGSQIK
YSCTKGYRLIGSSSATCIISGNTVIWDNKTPVCDRIICGLPPTIANGDFTSISREYFHYA
SVVTYHCNLGSGGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGIL
VSDNRSLFSLNEVVEFRCQPGFVMKGPRHVHCQALNKWEPELPSCSRVCQPPPDVLHGER
TQRDKDNFSPGEEVYYSCEPGYDLRGSTYLHCTPQGDWSPEAPRCEVKSCDDFLGQLPNG
RVLFPLNLQLGAKVDFVCDEKSCETPPVPVNGMVHVITDIHVGSRINYSCITGHRLIGHS
SAECILSGNTAHWSMKPPICQQIFCPNPPAILNGRHTGTPLGDIPYGKEVSYTCDPHPDR
GMTFNLIGESTIRCTSDPHGNGVWSSPAPRCELPVGAGSHDALIVGKFYEVFAEEFWHL
Download sequence
Identical sequences ENSPTRP00000054056 ENSPTRP00000054056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]