SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054454 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054454
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.62e-45
Family MHC antigen-recognition domain 0.00000601
Further Details:      
 
Domain Number 2 Region: 129-217
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-26
Family C1 set domains (antibody constant domain-like) 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054454   Gene: ENSPTRG00000018001   Transcript: ENSPTRT00000061910
Sequence length 266
Comment pep:known chromosome:CHIMP2.1.4:6:32909558:32921643:-1 gene:ENSPTRG00000018001 transcript:ENSPTRT00000061910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLKLPGGSCMAALTVTLMVLSSPLALSGDTRPRFLELVKSECHFFNGTERVRFLERYF
HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDYVEQKRGQVDNYCRHNYRVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTAFLS
Download sequence
Identical sequences ENSPTRP00000054454 ENSPTRP00000056708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]