SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054502 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054502
Domain Number 1 Region: 79-346
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.18e-58
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 33-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000129
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054502   Gene: ENSPTRG00000008335   Transcript: ENSPTRT00000061956
Sequence length 347
Comment pep:known chromosome:CHIMP2.1.4:16:71417317:71422041:1 gene:ENSPTRG00000008335 transcript:ENSPTRT00000061956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPQIAHGYVEHSVRYQCKNYYKLRT
EGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKM
VSRHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLH
PNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYV
MLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNKHTFCAGMSKYQEDTCYGDAGSAF
AVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
Download sequence
Identical sequences A0A2J8K9R5
ENSPTRP00000054502 NP_001190987.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]