SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054597 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054597
Domain Number 1 Region: 158-181
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054597   Gene: ENSPTRG00000017929   Transcript: ENSPTRT00000062046
Sequence length 188
Comment pep:known chromosome:CHIMP2.1.4:6:30902820:30910816:1 gene:ENSPTRG00000017929 transcript:ENSPTRT00000062046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRKKQNQHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHR
GPPGSRGPLIPPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTR
GSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDLCAFYH
PGVNGPPL
Download sequence
Identical sequences A0A2I3G9W9 K7DKJ8 Q7YR36
NP_001038964.1.37143 XP_003807414.1.60992 XP_012358627.1.23891 ENSPTRP00000054597 ENSPTRP00000054597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]