SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054613 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054613
Domain Number 1 Region: 227-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-49
Family SPRY domain 0.0000544
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000549
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 52-174
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000915
Family Apolipoprotein A-I 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054613   Gene: ENSPTRG00000017920   Transcript: ENSPTRT00000062062
Sequence length 396
Comment pep:known chromosome:CHIMP2.1.4:6:30539416:30548891:1 gene:ENSPTRG00000017920 transcript:ENSPTRT00000062062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDR
LRSRLEALSMERDEIEDVKCREDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLA
RLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQVIREGLHGCEMKT
FVSPEAISPDLVKKIRDFHRKILTLPEMMRMFSENLAHHLEIDSGVITLDPQTASRSLVL
SEDRKSVRYTRQKKNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDVQLGDGGGCTVGVAG
EGVRRKGEMGLSAEDGVWAVIISHQQCWASTSPGTDLPLSEIPRGVRVALDYEAGQVTLH
NAQTQEPIFTFTASFSGKVFPFFAVWKKGSYLTLKG
Download sequence
Identical sequences ENSPTRP00000054613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]