SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054616 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054616
Domain Number 1 Region: 307-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-45
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 8-84
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000054616
Domain Number - Region: 130-204
Classification Level Classification E-value
Superfamily STAT 0.00294
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054616   Gene: ENSPTRG00000017919   Transcript: ENSPTRT00000062065
Sequence length 480
Comment pep:known chromosome:CHIMP2.1.4:6:30530875:30537227:-1 gene:ENSPTRG00000017919 transcript:ENSPTRT00000062065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLC
KEPFRPGSFRPNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV
CREAGEHATHTMRFLEDAAAPYREQIHKCLKRLRKEREETQEIQSRENKRMQVLLTQVST
KRQQVISEFAHLRKFLEEQQSILLAQLESLDGDILKQRDEFDLLIAGESCRFSALIEELE
EKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRIRDFPQQALPLQREMKMFLVN
MSLLVIPTAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDRATCVLAHTGIT
GGRHTWVVSIDLAHGGSCTVGVVSEDVQRKGELRLRPEEGVWAVRLAWGFVSALGSFPTR
LTLKEQPWQVRVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFFLSS
Download sequence
Identical sequences ENSPTRP00000054616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]