SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054833 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054833
Domain Number 1 Region: 204-316
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-44
Family V set domains (antibody variable domain-like) 0.0000012
Further Details:      
 
Domain Number 2 Region: 315-386
Classification Level Classification E-value
Superfamily Immunoglobulin 7.05e-27
Family C2 set domains 0.0000239
Further Details:      
 
Domain Number 3 Region: 28-115
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-17
Family V set domains (antibody variable domain-like) 0.0000119
Further Details:      
 
Domain Number 4 Region: 127-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000293
Family C2 set domains 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054833   Gene: ENSPTRG00000004590   Transcript: ENSPTRT00000062277
Sequence length 458
Comment pep:known chromosome:CHIMP2.1.4:12:6952286:6983565:1 gene:ENSPTRG00000004590 transcript:ENSPTRT00000062277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQTK
ILGNQGSFLTKGPSKLNDRVDSRRSLWDQGNFTLIIKNLKIEDSDTYICEVGDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAQRMSQIKRKLSVWPSCRCPRRFQKTCSPI
Download sequence
Identical sequences ENSPTRP00000054833 9598.ENSPTRP00000054833 ENSPTRP00000054833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]