SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054849 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054849
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 3.61e-53
Family Globins 0.0000000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054849   Gene: ENSPTRG00000003238   Transcript: ENSPTRT00000062293
Sequence length 147
Comment pep:known chromosome:CHIMP2.1.4:11:4983807:4985604:-1 gene:ENSPTRG00000003238 transcript:ENSPTRT00000062293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFG
KEFTPQVQAAYQKVVAGVANALAHKYH
Download sequence
Identical sequences A0A1K0GXZ8 A0A1K0GY03 G1S6C6 P61772 P61773 P61774 P61775
ENSPTRP00000054849 XP_001162045.2.37143 XP_002822175.1.23681 XP_003254870.1.23891 XP_003819079.1.60992 ENSNLEP00000021065 9600.ENSPPYP00000004107 ENSPTRP00000054849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]